Sign In | Join Free | My dvasoft.com
dvasoft.com
Products
Search by Category
Wholesale Marketplace
Home > Environment >

Water Treatment

Water Treatment

All Water Treatment wholesalers & Water Treatment manufacturers come from members. We doesn't provide Water Treatment products or service, please contact them directly and verify their companies info carefully.

Total 14998 products from Water Treatment Manufactures & Suppliers
Buy cheap SD-AF315 Angle fitting welding machine from Wholesalers

Brand Name:Sinobada

Model Number:SD-AF315

Application and features : ※ Applies in the workshop production of PE, PP, PVDF elbow, equal tee, four-way such as diameter, extended injection short pipe fittings, production pipe assembly; 45 ° and 60 ° y-shaped tee (Y type tee needs to choose and ...

Sinobada Polyfusion Welding Machine Co.,Ltd.
Active Member

Buy cheap 80MM LED point light, source DMX control from Wholesalers

Brand Name:SHIERGE

Place of Origin:CHINA

... method: Constant voltage 9.Outside material: PC 10.Each light an individual loop, cut and reconnect 11.Used directly outdoor Applications: Ideal for creating big characters on the top of the building...

Shierge Technology Co., Limited
Active Member

Guangdong

Buy cheap Hansel attractions kids play area inflatable water park slide for kids playground from Wholesalers

Brand Name:Hansel inflatable bouncers

Model Number:HS81 inflatable bouncers

Place of Origin:China inflatable bouncers

Hansel attractions kids play area inflatable water park slide for kids playground Hansel inflatable games FAQ of Hansel inflatable products What ages can go on your inflatable products? Our inflautable products are suitable for children and adults,it is ...

Guangzhou Hansel Electronic Technology Co., LTD
Site Member

Guangdong

Buy cheap Colorful Neoprene Lip Balm Holder/keychain/chapstick holder.size is 10.5cm*5.5cm 3mm Neoprene material. from Wholesalers

Brand Name:No

Model Number:no

Place of Origin:China

Colorful Neoprene Lip Balm Holder/keychain/chapstick holder. Product Colorful Neoprene Lip Balm Holder/Keychain/Chapstick holder. Materail SBR Size 10.5*5.5cm, 3mm thickness Qty/Carton Custom MOQ 1000pcs Payment term T/T, Paypal, , Trade Assurance in our ...

Dongguan Colorful gift products manufactory
Site Member

Guangdong

Buy cheap tower building clock, outdoor clocks, wall clocks for hotel building, church clocks, movement for tower wall clocks from Wholesalers

Brand Name:timemate

Place of Origin:China

Manufacturer and supplier of indoor and outdoor clocks, clock parts including movement/mechanism, clock hand, face dial, marks, master clock, etc., with good quality, welcome your enquiries, we'll offer you quality products, reasonable prices, and best ...

GOOD CLOCK (YANTAI) TRUST-WELL CO LTD.
Site Member

Shandong

Buy cheap White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer from Wholesalers

Brand Name:Youngshe

Model Number:High quality

Place of Origin:China

White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic ...

Chengdu YoungShe Chemical Co., Ltd
Site Member

Sichuan

Buy cheap RUBBER EXPANSION JOINT WITH CONTROL RODS from Wholesalers

Brand Name:YU-XIANG

Model Number:KXT

Place of Origin:CHINA

Rubber expansion joints compensate for axial, lateral and angular movements resulting from thermal changes in pipeline length. They prevent the transmission of mechanical vibrations from machines, apparatus or pumps to the connected pipeline. They ...

Gongyi Yuxiang Water Supply Materials CO.LTD
Active Member

Henan

Buy cheap fiber cement board equipmnet China from Wholesalers

Brand Name:Xiangyi

Place of Origin:Hebei, China

fiber cement board equipmnet Fiber Cement Board Production Line main material : silicon materials: quartz powder, diatomite, fly ash, etc. calcium materials: hydrated lime powder, cement, calcium carbide mud, etc. Length: 1200-1220mm Width:2400-2440mm ...

Hebei Xiangyi Mechanical Co.,Ltd
Active Member

Liaoning

Buy cheap New Printing Fabric of Spring Table Cover in 2018 from Wholesalers

Brand Name:kingsun

Model Number:WKY170920-9

Place of Origin:China

Details 1.Bright color, color uniformity,resistant to crushing and printable nice. 2.Soft hand feeling. 3.a variety of embroideries. 4.Good Quality:We have strict quality control system .Good reputation in the market. 5.Low MOQ: we can meet your ...

SHIJIAZHUANG KINGSUN TEXTILE IMP. & EXP. CO., LTD
Active Member

Buy cheap clutch disc 3478359M91 from Wholesalers

Place of Origin:jiangsuyancheng

Brand Name:szc

LM-TR04023 1865836M91 , 3478359M91 251X165MM Mf285 TRACTOR PARTS MASSEY FERGUSON CLUTCH DISC PARTS Factory Number LuK 325010847 MASSEY... 1865836M91 MASSEY... 3478359M91 MASSEY... 3478359R91 TRIPLE... 3025R0300 KAWE 2137

YanCheng JIAHANG Clutch Co., Ltd.
Site Member

Jiangsu

Buy cheap Alkalized Cocoa Powder JH01/JH02/JH03 Light brown to brown from Wholesalers

Brand Name:huide

Model Number:JH01

Place of Origin:CHINA

Products Info:Natural cocoa powder is made from COCOA CAKE, COCOA BEANS, COCOA NIBS AND COCOA LIQUOR, can be used to made chocolate, bakery, beverages, cakes, compound chocolate coating and filling, dairy products, desserts, fillings, frosting, ice cream,...

wuxi huide food co.,ltd
Active Member

Buy cheap Water Treatment Materials from Wholesalers

Categories:UPS Lead Acid Battery

Telephone:+86 10 61428699

Country/Region:china

Water Treatment Materials Product Item: Water Treatment Glass Beads Category: Water Treatment Glass Beads Views: 367 Product Manual:Water Treatment Glass Beads,Sandblasting Glass Beads, Airport Marking Glass Beads,1.5 Index Glass Beads, BS6088 Class A,...

Landscapus Inc limited
ICP Remarked Supplier

Buy cheap New design decorative metal perforated panels stainless steel screen for wall panels from Wholesalers

Brand Name:Screen Partition

Model Number:stainless steel,aluminum,brass,metal

Place of Origin:China stainless steel metal screen

WELCOME TO OUR COMPANY Why choose us? 1. Professional team Over 8 years experience in metal manufacturing Providing design & fabrication solutions for metal architectural decoration projects 2. Multiple options We supply all kinds of Stainless Steel ...

Foshan Xin Tai Jia Stainless Steel Co.,Ltd
Site Member

Guangdong

Buy cheap Water treatment AC GAC from Wholesalers

Categories:Water Treatment Equipments

Telephone:86-351-2792757

Country/Region:china

:Home > Product > Water treatment AC > GAC Mark & modelXJ-PJ830 is mainly used in the deep purification of drinking water and daily wasted water as well as dechlorination, oil removal, deodorization and decolorization of industrial water of ...

Xin Jie Activated Carbon Co. Ltd
ICP Remarked Supplier

Shanxi

Buy cheap Shavings Bagger For Sale from Wholesalers

Brand Name:SINOBALER

Place of Origin:CHINA

SINOBALER shavings bagger has the combined function of baling and bagging in one machine. It is ideal for compacting small and loose materials like wood shavings/chips, sawdust and rice husk etc. View more details at http://www.sinobaler.com/wood-shavings...

SINOBALER Machinery Company Limited
Active Member

Buy cheap arch rubber fender supplier from Wholesalers

Brand Name:TLT

Model Number:cone 1300

Place of Origin:SHANDONG CHINA

arch marine rubber fender , DA type boat fender Specification We are a venture specializing in the manufacture and export of rubber fender. You may visit our online company introduction at Http://www.zytlt.com which includes our latest product line. ...

ZHAOYUAN TALENT PLASTIC CHEMICAL CO.,LTD
Active Member

Buy cheap Factory Direct Price Leech Drying Equipment from Wholesalers

Brand Name:dryfree

Model Number:DF/HP-12/F

Place of Origin:China(mainland),guangdong

Drying Case Show Product Description Fish Dehydrator Low Temperature With Strong Dehumidity Integrated Heat Pump Dry Machine * Size : 2500 L x 1200W x 1500H * Same material as integrated system with special design to increase Evaporator size only for some...

Dongguan Dryfree Technology Equipment Co., Ltd.
Active Member

Buy cheap Water Reuse MBR membrane water reuse system from Wholesalers

Categories:Drinking Water Filling Machine

Telephone:+86-21-61399102 +86-21-61399103

Country/Region:china

MBR membrane water reuse system Product Name:Integration of membrane bioreactor Product Information:Advanced and reliable intelligent integration of membrane bioreactor for processing sewage and waste of various types of industrial enterprises, ...

Shanghai Cheng Hua Environmental Engineering Co., Ltd
ICP Remarked Supplier

Shanghai

Buy cheap Water Treatments BasolanDC(BASF) CAS:2893-78-9 from Wholesalers

Categories:Packaging Materials

Telephone:0086-592-8851735

Country/Region:china

BasolanDC(BASF) CAS:2893-78-9 Package5KGS/50KGS/ 200KGS/UN DRUM CAS2893-78-9 Introduction Product Name BasolanDC(BASF) Synonyms 1,3,5-Triazine-2,4,6-(1H,3H,5H)trione,1,3-dichloro,sodiumsalt;1,3,5-Triazine-2,4,6(1H,3H,5H)-trione,1,3-dichloro-,sodiumsalt...

Cheerlong Co., Ltd.
ICP Remarked Supplier

Buy cheap Waste Water / Process Water Prefab Tanks from Wholesalers

Categories:Inline Water Booster Pump

Country/Region:china

There are many reasons why we must move forward with the wastewater project for the core area, not only to meet the federal regulations and provincial requirements. Managing wastewater is more than just selecting the technology; it also involves testing ...

coepenviro limited
ICP Remarked Supplier

Go to Page
Inquiry Cart 0